PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna17723.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bHLH
Protein Properties Length: 229aa    MW: 26014.4 Da    PI: 6.6069
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna17723.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH29.31.5e-092875655
                             HHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                      HLH  6 nerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                               +E++RR++++  +++L +llP++   +++ +s  e   +A++YIk L+
  mrna17723.1-v1.0-hybrid 28 RVIEKNRRNHMKILYSQLNSLLPNQ--HSKEPVSLPEQIDEAINYIKTLE 75
                             579*********************7..26666***************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088811.6872274IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.31E-112392IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000837.49E-52475No hitNo description
Gene3DG3DSA:4.10.280.105.0E-102789IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000105.5E-62875IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MGILVPDDAK QVMENTQLTT SGSKIERRVI EKNRRNHMKI LYSQLNSLLP NQHSKEPVSL  60
PEQIDEAINY IKTLESNMQK LKQKRDNLKI GRKRSYELCS SSSSTRSAAA TSTAKSPQIQ  120
IHEIGSTLEV VLSTGLHNQF IFYDIIRILD QEQADVVHAS FSASGDSILH LVRAEMGNLI  180
LDFGAAKITE KLKRIVYGSA SDEELQHDDH NQDYYLWDFQ IHPQMWDF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18393KRDNLKIGRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004303146.11e-170PREDICTED: transcription factor bHLH118-like isoform X2
TrEMBLM5VT391e-87M5VT39_PRUPE; Uncharacterized protein
STRINGGLYMA12G12880.13e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9063498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.18e-33bHLH family protein